Class a: All alpha proteins [46456] (290 folds) |
Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily) multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer |
Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat |
Family a.204.1.2: MazG-like [116993] (4 proteins) Pfam PF03819 |
Protein XTP3-transactivated gene A protein homolog RS21-C6 [140792] (1 species) confirmed prediction of the m5dCTPase activity |
Species Mouse (Mus musculus) [TaxId:10090] [140793] (4 PDB entries) Uniprot Q9QY93 22-134 |
Domain d2oiea1: 2oie A:21-122 [139092] Other proteins in same PDB: d2oieb2, d2oiec2, d2oied2 complexed with so4 |
PDB Entry: 2oie (more details), 2.2 Å
SCOPe Domain Sequences for d2oiea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oiea1 a.204.1.2 (A:21-122) XTP3-transactivated gene A protein homolog RS21-C6 {Mouse (Mus musculus) [TaxId: 10090]} rpfrfspeptledirrlhaefaaerdweqfhqprnlllalvgevgelaelfqwksdtepg pqawppkeraalqeelsdvliylvalaarchvdlpqaviskm
Timeline for d2oiea1: