Lineage for d2oi6b2 (2oi6 B:4-251)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1178199Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1178200Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1178281Family c.68.1.5: UDP-glucose pyrophosphorylase [53461] (3 proteins)
  6. 1178282Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain [53462] (2 species)
  7. 1178283Species Escherichia coli [TaxId:562] [53463] (6 PDB entries)
  8. 1178287Domain d2oi6b2: 2oi6 B:4-251 [139087]
    Other proteins in same PDB: d2oi6a1, d2oi6b1
    automatically matched to d1fwya2
    complexed with co, coa, gp1, mg, so4, ud1

Details for d2oi6b2

PDB Entry: 2oi6 (more details), 2.2 Å

PDB Description: e. coli glmu- complex with udp-glcnac, coa and glcn-1-po4
PDB Compounds: (B:) Bifunctional protein glmU

SCOPe Domain Sequences for d2oi6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oi6b2 c.68.1.5 (B:4-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]}
namsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggdllk
qalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrdakpq
ggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadmkrw
lakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyqseq
aeklllag

SCOPe Domain Coordinates for d2oi6b2:

Click to download the PDB-style file with coordinates for d2oi6b2.
(The format of our PDB-style files is described here.)

Timeline for d2oi6b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oi6b1