Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.5: UDP-glucose pyrophosphorylase [53461] (4 proteins) |
Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain [53462] (3 species) |
Species Escherichia coli [TaxId:562] [53463] (6 PDB entries) |
Domain d2oi5b2: 2oi5 B:3-251 [139083] Other proteins in same PDB: d2oi5a1, d2oi5b1 automated match to d1hv9b2 complexed with aco, mg, so4, ud1 |
PDB Entry: 2oi5 (more details), 2.25 Å
SCOPe Domain Sequences for d2oi5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oi5b2 c.68.1.5 (B:3-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]} nnamsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggdll kqalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrdakp qggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadmkr wlakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyqse qaeklllag
Timeline for d2oi5b2: