SCOP 1.73: Domain d2of2a1: 2of2 A:231-498

Lineage for d2of2a1 (2of2 A:231-498)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Lymphocyte kinase (lck) [56153] (1 species)
   PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56154] (10 PDB entries)

8. Domain d2of2a1: 2of2 A:231-498 [139042]
   automatically matched to d1qpca_
   complexed with 547

Details for d2of2a1

PDB Entry: 2of2, 2 Å

PDB Description: crystal structure of furanopyrimidine 8 bound to lck

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase LCK

SCOP Domain Sequences for d2of2a1:

Sequence; same for both SEQRES and ATOM records:

>d2of2a1 d.144.1.7 (A:231-498) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]}
kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean
lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae
gmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtape
ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely
qlmrlcwkerpedrptfdylrsvledff

Timeline for d2of2a1:

• d2of2a1 is new in SCOP 1.73
  
• d2of2a1 appears in SCOP 1.75
  
• d2of2a1 appears in the current release, SCOPe 2.08, called d2of2a_