Lineage for d2ocjc_ (2ocj C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1300526Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1300967Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 1300968Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 1301058Protein automated matches [190198] (2 species)
    not a true protein
  7. 1301059Species Human (Homo sapiens) [TaxId:9606] [186941] (37 PDB entries)
  8. 1301123Domain d2ocjc_: 2ocj C: [139010]
    automated match to d3igla_
    complexed with zn

Details for d2ocjc_

PDB Entry: 2ocj (more details), 2.05 Å

PDB Description: human p53 core domain in the absence of dna
PDB Compounds: (C:) p53 tumor suppressor

SCOPe Domain Sequences for d2ocjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ocjc_ b.2.5.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
vvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvc
acpgrdrrteeenl

SCOPe Domain Coordinates for d2ocjc_:

Click to download the PDB-style file with coordinates for d2ocjc_.
(The format of our PDB-style files is described here.)

Timeline for d2ocjc_: