Lineage for d2ocjc_ (2ocj C:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. Protein automated matches [190198] (2 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [186941] (51 PDB entries)
  8. Domain d2ocjc_: 2ocj C: [139010]
    automated match to d3igla_
    complexed with zn

Details for d2ocjc_

PDB Entry: 2ocj (more details), 2.05 Å

PDB Description: human p53 core domain in the absence of dna
PDB Compounds: (C:) p53 tumor suppressor

SCOPe Domain Sequences for d2ocjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ocjc_ b.2.5.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
vvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvc
acpgrdrrteeenl

SCOPe Domain Coordinates for d2ocjc_ are not available.

Timeline for d2ocjc_:

Domains from other chains:
(mouse over for more information)
d2ocja_, d2ocjb_, d2ocjd_