SCOPe 2.08: Domain d2ob2b_: 2ob2 B:

Lineage for d2ob2b_ (2ob2 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.37: Leucine carboxy methyltransferase Ppm1 [102569] (1 protein)

6. Protein Leucine carboxy methyltransferase Ppm1 [102570] (1 species)
   involved in the regulation of protein phosphatase 2a activity

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102571] (6 PDB entries)

8. Domain d2ob2b_: 2ob2 B: [139002]
   automated match to d1rjda_
   complexed with gol, po4, sah

Details for d2ob2b_

PDB Entry: 2ob2, 1.92 Å

PDB Description: ppm1 in the absence of 1,8-ANS (cf 1JD)

PDB Compounds: (B:) Leucine carboxyl methyltransferase 1

SCOPe Domain Sequences for d2ob2b_:

Sequence; same for both SEQRES and ATOM records:

>d2ob2b_ c.66.1.37 (B:) Leucine carboxy methyltransferase Ppm1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eriiqqtdydalscklaaisvgylpssglqrlsvdlskkytewhrsylitlkkfsrrafg
kvdkamrssfpvmnygtylrtvgidaaileflvanekvqvvnlgcgsdlrmlpllqmfph
layvdidynesvelknsilreseilrislglskedtakspflidqgryklaacdlndite
ttrlldvctkreiptivisecllcymhnnesqllintimskfshglwisydpiggsqpnd
rfgaimqsnlkesrnlemptlmtynskekyasrwsaapnvivndmweifnaqipeserkr
lrslqfldeleelkvmqthyilmkaqw

Timeline for d2ob2b_:

• d2ob2b_ first appeared in SCOP 1.73, called d2ob2b1
  
• d2ob2b_ appears in SCOPe 2.07