Lineage for d2oaug2 (2oau G:180-280)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1418276Superfamily d.58.43: Mechanosensitive channel protein MscS (YggB), C-terminal domain [82689] (1 family) (S)
    the last strand of the fold is flipped away and involved in oligomerisation
  5. 1418277Family d.58.43.1: Mechanosensitive channel protein MscS (YggB), C-terminal domain [82690] (1 protein)
  6. 1418278Protein Mechanosensitive channel protein MscS (YggB), C-terminal domain [82691] (1 species)
  7. 1418279Species Escherichia coli [TaxId:562] [82692] (2 PDB entries)
  8. 1418293Domain d2oaug2: 2oau G:180-280 [138997]
    Other proteins in same PDB: d2oaua1, d2oaua3, d2oaub1, d2oaub3, d2oauc1, d2oauc3, d2oaud1, d2oaud3, d2oaue1, d2oaue3, d2oauf1, d2oauf3, d2oaug1, d2oaug3
    automatically matched to d1mxma2

Details for d2oaug2

PDB Entry: 2oau (more details), 3.7 Å

PDB Description: Mechanosensitive Channel of Small Conductance (MscS)
PDB Compounds: (G:) Small-conductance mechanosensitive channel

SCOPe Domain Sequences for d2oaug2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oaug2 d.58.43.1 (G:180-280) Mechanosensitive channel protein MscS (YggB), C-terminal domain {Escherichia coli [TaxId: 562]}
repvrrnefiigvaydsdidqvkqiltniiqsedrilkdremtvrlnelgassinfvvrv
wsnsgdlqnvywdvlerikrefdaagisfpypqmdvnfkrv

SCOPe Domain Coordinates for d2oaug2:

Click to download the PDB-style file with coordinates for d2oaug2.
(The format of our PDB-style files is described here.)

Timeline for d2oaug2: