SCOP 1.73: Domain d2oaug2: 2oau G:180-280

Lineage for d2oaug2 (2oau G:180-280)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.43: Mechanosensitive channel protein MscS (YggB), C-terminal domain [82689] (1 family)
   the last strand of the fold is flipped away and involved in oligomerisation

5. Family d.58.43.1: Mechanosensitive channel protein MscS (YggB), C-terminal domain [82690] (1 protein)

6. Protein Mechanosensitive channel protein MscS (YggB), C-terminal domain [82691] (1 species)

7. Species Escherichia coli [TaxId:562] [82692] (1 PDB entry)

8. Domain d2oaug2: 2oau G:180-280 [138997]
   Other proteins in same PDB: d2oaua1, d2oaua3, d2oaub1, d2oaub3, d2oauc1, d2oauc3, d2oaud1, d2oaud3, d2oaue1, d2oaue3, d2oauf1, d2oauf3, d2oaug1, d2oaug3
   automatically matched to d1mxma2

Details for d2oaug2

PDB Entry: 2oau, 3.7 Å

PDB Description: Mechanosensitive Channel of Small Conductance (MscS)

PDB Compounds: (G:) Small-conductance mechanosensitive channel

SCOP Domain Sequences for d2oaug2:

Sequence; same for both SEQRES and ATOM records:

>d2oaug2 d.58.43.1 (G:180-280) Mechanosensitive channel protein MscS (YggB), C-terminal domain {Escherichia coli [TaxId: 562]}
repvrrnefiigvaydsdidqvkqiltniiqsedrilkdremtvrlnelgassinfvvrv
wsnsgdlqnvywdvlerikrefdaagisfpypqmdvnfkrv

Timeline for d2oaug2:

• d2oaug2 is new in SCOP 1.73
  
• d2oaug2 appears in SCOP 1.75
  
• d2oaug2 appears in the current release, SCOPe 2.08