Lineage for d2oauc1 (2oau C:113-179)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666911Fold b.38: Sm-like fold [50181] (3 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 666912Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (5 families) (S)
  5. 667203Family b.38.1.3: Mechanosensitive channel protein MscS (YggB), middle domain [82090] (1 protein)
  6. 667204Protein Mechanosensitive channel protein MscS (YggB), middle domain [82091] (1 species)
    forms homoheptameric ring structure very similar to those of the archaeal and eukaryotic Sm proteins
  7. 667205Species Escherichia coli [TaxId:562] [82092] (1 PDB entry)
  8. 667208Domain d2oauc1: 2oau C:113-179 [138984]
    Other proteins in same PDB: d2oaua2, d2oaua3, d2oaub2, d2oaub3, d2oauc2, d2oauc3, d2oaud2, d2oaud3, d2oaue2, d2oaue3, d2oauf2, d2oauf3, d2oaug2, d2oaug3
    automatically matched to d1mxma1

Details for d2oauc1

PDB Entry: 2oau (more details), 3.7 Å

PDB Description: Mechanosensitive Channel of Small Conductance (MscS)
PDB Compounds: (C:) Small-conductance mechanosensitive channel

SCOP Domain Sequences for d2oauc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oauc1 b.38.1.3 (C:113-179) Mechanosensitive channel protein MscS (YggB), middle domain {Escherichia coli [TaxId: 562]}
gslsnlaagvllvmfrpfrageyvdlggvagtvlsvqifsttmrtadgkiivipngkiia
gniinfs

SCOP Domain Coordinates for d2oauc1:

Click to download the PDB-style file with coordinates for d2oauc1.
(The format of our PDB-style files is described here.)

Timeline for d2oauc1: