Lineage for d2oauf1 (2oau F:113-179)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 948630Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 948631Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 948993Family b.38.1.3: Mechanosensitive channel protein MscS (YggB), middle domain [82090] (1 protein)
  6. 948994Protein Mechanosensitive channel protein MscS (YggB), middle domain [82091] (1 species)
    forms homoheptameric ring structure very similar to those of the archaeal and eukaryotic Sm proteins
  7. 948995Species Escherichia coli [TaxId:562] [82092] (2 PDB entries)
  8. 949008Domain d2oauf1: 2oau F:113-179 [138993]
    Other proteins in same PDB: d2oaua2, d2oaua3, d2oaub2, d2oaub3, d2oauc2, d2oauc3, d2oaud2, d2oaud3, d2oaue2, d2oaue3, d2oauf2, d2oauf3, d2oaug2, d2oaug3
    automatically matched to d1mxma1

Details for d2oauf1

PDB Entry: 2oau (more details), 3.7 Å

PDB Description: Mechanosensitive Channel of Small Conductance (MscS)
PDB Compounds: (F:) Small-conductance mechanosensitive channel

SCOPe Domain Sequences for d2oauf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oauf1 b.38.1.3 (F:113-179) Mechanosensitive channel protein MscS (YggB), middle domain {Escherichia coli [TaxId: 562]}
gslsnlaagvllvmfrpfrageyvdlggvagtvlsvqifsttmrtadgkiivipngkiia
gniinfs

SCOPe Domain Coordinates for d2oauf1:

Click to download the PDB-style file with coordinates for d2oauf1.
(The format of our PDB-style files is described here.)

Timeline for d2oauf1: