Lineage for d2oaud3 (2oau D:27-112)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1239485Fold f.34: Mechanosensitive channel protein MscS (YggB), transmembrane region [82860] (1 superfamily)
    oligomeric fold; 3 transmembrane helices per subunit
  4. 1239486Superfamily f.34.1: Mechanosensitive channel protein MscS (YggB), transmembrane region [82861] (1 family) (S)
  5. 1239487Family f.34.1.1: Mechanosensitive channel protein MscS (YggB), transmembrane region [82862] (1 protein)
  6. 1239488Protein Mechanosensitive channel protein MscS (YggB), transmembrane region [82863] (1 species)
    homoheptameric protein
  7. 1239489Species Escherichia coli [TaxId:562] [82864] (2 PDB entries)
  8. 1239500Domain d2oaud3: 2oau D:27-112 [138989]
    Other proteins in same PDB: d2oaua1, d2oaua2, d2oaub1, d2oaub2, d2oauc1, d2oauc2, d2oaud1, d2oaud2, d2oaue1, d2oaue2, d2oauf1, d2oauf2, d2oaug1, d2oaug2
    automatically matched to d1mxma3

Details for d2oaud3

PDB Entry: 2oau (more details), 3.7 Å

PDB Description: Mechanosensitive Channel of Small Conductance (MscS)
PDB Compounds: (D:) Small-conductance mechanosensitive channel

SCOPe Domain Sequences for d2oaud3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oaud3 f.34.1.1 (D:27-112) Mechanosensitive channel protein MscS (YggB), transmembrane region {Escherichia coli [TaxId: 562]}
yavnivaalaiiivgliiarmisnavnrlmisrkidatvadflsalvrygiiaftliaal
grvgvqtasviavlgaaglavglalq

SCOPe Domain Coordinates for d2oaud3:

Click to download the PDB-style file with coordinates for d2oaud3.
(The format of our PDB-style files is described here.)

Timeline for d2oaud3: