Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.16: Gated mechanosensitive channel [81331] (1 superfamily) oligomeric transmembrane alpha-helical protein |
Superfamily f.16.1: Gated mechanosensitive channel [81330] (1 family) automatically mapped to Pfam PF01741 |
Family f.16.1.1: Gated mechanosensitive channel [81329] (1 protein) |
Protein Gated mechanosensitive channel [56904] (1 species) Large-conductance ion channel |
Species Mycobacterium tuberculosis [TaxId:1773] [56905] (1 PDB entry) |
Domain d2oare1: 2oar E:10-118 [138977] automatically matched to d1msla_ complexed with au |
PDB Entry: 2oar (more details), 3.5 Å
SCOPe Domain Sequences for d2oare1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oare1 f.16.1.1 (E:10-118) Gated mechanosensitive channel {Mycobacterium tuberculosis [TaxId: 1773]} argnivdlavavvigtaftalvtkftdsiitplinrigvnaqsdvgilrigigggqtidl nvllsaainffliafavyflvvlpyntlrkkgeveqpgdtqvvllteir
Timeline for d2oare1:
View in 3D Domains from other chains: (mouse over for more information) d2oara1, d2oarb1, d2oarc1, d2oard1 |