Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein Class pi GST [81358] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [52866] (9 PDB entries) |
Domain d2oa7b2: 2oa7 B:1-78 [138964] Other proteins in same PDB: d2oa7a1, d2oa7b1 automated match to d3hkrb1 complexed with gtx; mutant |
PDB Entry: 2oa7 (more details), 2.2 Å
SCOPe Domain Sequences for d2oa7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oa7b2 c.47.1.5 (B:1-78) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]} ppytivyfpvrgraeamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl tlyqsnailrhlgrslgl
Timeline for d2oa7b2: