Lineage for d2o0pa1 (2o0p A:2-114)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1939878Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 1939879Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 1940159Family d.166.1.7: CC0527-like [143950] (1 protein)
    Pfam PF06108; DUF952
  6. 1940160Protein Hypothetical protein CC0527 [143951] (1 species)
  7. 1940161Species Caulobacter crescentus [TaxId:155892] [143952] (3 PDB entries)
    Uniprot Q9AAR9 2-114
  8. 1940163Domain d2o0pa1: 2o0p A:2-114 [138866]
    mutant

Details for d2o0pa1

PDB Entry: 2o0p (more details), 1.9 Å

PDB Description: x-ray crystal structure of protein cc0527 (v27m / l66m double mutant) from caulobacter crescentus. northeast structural genomics consortium target ccr55.
PDB Compounds: (A:) Hypothetical protein CC0527

SCOPe Domain Sequences for d2o0pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o0pa1 d.166.1.7 (A:2-114) Hypothetical protein CC0527 {Caulobacter crescentus [TaxId: 155892]}
tliykilsraewdaakaqgrfegsamdladgfihlsageqaqetaakwfrgqanlvllav
eaepmgedlkweasrggarfphlyrpllvsevtreadldldadgvpqlgdhla

SCOPe Domain Coordinates for d2o0pa1:

Click to download the PDB-style file with coordinates for d2o0pa1.
(The format of our PDB-style files is described here.)

Timeline for d2o0pa1: