Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.7: CC0527-like [143950] (1 protein) Pfam PF06108; DUF952 |
Protein Hypothetical protein CC0527 [143951] (1 species) |
Species Caulobacter crescentus [TaxId:155892] [143952] (3 PDB entries) Uniprot Q9AAR9 2-114 |
Domain d2o0pa1: 2o0p A:2-114 [138866] mutant |
PDB Entry: 2o0p (more details), 1.9 Å
SCOPe Domain Sequences for d2o0pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o0pa1 d.166.1.7 (A:2-114) Hypothetical protein CC0527 {Caulobacter crescentus [TaxId: 155892]} tliykilsraewdaakaqgrfegsamdladgfihlsageqaqetaakwfrgqanlvllav eaepmgedlkweasrggarfphlyrpllvsevtreadldldadgvpqlgdhla
Timeline for d2o0pa1: