SCOPe 2.08: Domain d2o0pa1: 2o0p A:2-114

Lineage for d2o0pa1 (2o0p A:2-114)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.7: CC0527-like [143950] (1 protein)
   Pfam PF06108; DUF952

6. Protein Hypothetical protein CC0527 [143951] (1 species)

7. Species Caulobacter crescentus [TaxId:155892] [143952] (3 PDB entries)
   Uniprot Q9AAR9 2-114

8. Domain d2o0pa1: 2o0p A:2-114 [138866]
   Other proteins in same PDB: d2o0pa2
   mutant

Details for d2o0pa1

PDB Entry: 2o0p, 1.9 Å

PDB Description: x-ray crystal structure of protein cc0527 (v27m / l66m double mutant) from caulobacter crescentus. northeast structural genomics consortium target ccr55.

PDB Compounds: (A:) Hypothetical protein CC0527

SCOPe Domain Sequences for d2o0pa1:

Sequence; same for both SEQRES and ATOM records:

>d2o0pa1 d.166.1.7 (A:2-114) Hypothetical protein CC0527 {Caulobacter crescentus [TaxId: 155892]}
tliykilsraewdaakaqgrfegsamdladgfihlsageqaqetaakwfrgqanlvllav
eaepmgedlkweasrggarfphlyrpllvsevtreadldldadgvpqlgdhla

Timeline for d2o0pa1:

• d2o0pa1 first appeared in SCOP 1.73
  
• d2o0pa1 appears in SCOPe 2.07