Lineage for d2nymf1 (2nym F:2-294)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938246Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1938247Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1938325Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 1938331Protein Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha [143933] (1 species)
  7. 1938332Species Human (Homo sapiens) [TaxId:9606] [143934] (12 PDB entries)
    Uniprot P67775 2-294
  8. 1938348Domain d2nymf1: 2nym F:2-294 [138826]
    Other proteins in same PDB: d2nyma1, d2nymb1, d2nymd1, d2nyme1
    automatically matched to 2NYL C:2-294
    complexed with mn

Details for d2nymf1

PDB Entry: 2nym (more details), 3.6 Å

PDB Description: crystal structure of protein phosphatase 2a (pp2a) with c-terminus truncated catalytic subunit
PDB Compounds: (F:) Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform

SCOPe Domain Sequences for d2nymf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nymf1 d.159.1.3 (F:2-294) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]}
dekvftkeldqwieqlneckqlsesqvkslcekakeiltkesnvqevrcpvtvcgdvhgq
fhdlmelfriggkspdtnylfmgdyvdrgyysvetvtllvalkvryreritilrgnhesr
qitqvygfydeclrkygnanvwkyftdlfdylpltalvdgqifclhgglspsidtldhir
aldrlqevphegpmcdllwsdpddrggwgisprgagytfgqdisetfnhangltlvsrah
qlvmegynwchdrnvvtifsapnycyrcgnqaaimelddtlkysflqfdpapr

SCOPe Domain Coordinates for d2nymf1:

Click to download the PDB-style file with coordinates for d2nymf1.
(The format of our PDB-style files is described here.)

Timeline for d2nymf1: