SCOPe 2.08: Domain d2nymf1: 2nym F:2-294

Lineage for d2nymf1 (2nym F:2-294)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)

6. Protein Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha [143933] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143934] (12 PDB entries)
   Uniprot P67775 2-294

8. Domain d2nymf1: 2nym F:2-294 [138826]
   Other proteins in same PDB: d2nyma1, d2nymb1, d2nymd1, d2nyme1
   automatically matched to 2NYL C:2-294
   complexed with mn

Details for d2nymf1

PDB Entry: 2nym, 3.6 Å

PDB Description: crystal structure of protein phosphatase 2a (pp2a) with c-terminus truncated catalytic subunit

PDB Compounds: (F:) Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform

SCOPe Domain Sequences for d2nymf1:

Sequence; same for both SEQRES and ATOM records:

>d2nymf1 d.159.1.3 (F:2-294) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]}
dekvftkeldqwieqlneckqlsesqvkslcekakeiltkesnvqevrcpvtvcgdvhgq
fhdlmelfriggkspdtnylfmgdyvdrgyysvetvtllvalkvryreritilrgnhesr
qitqvygfydeclrkygnanvwkyftdlfdylpltalvdgqifclhgglspsidtldhir
aldrlqevphegpmcdllwsdpddrggwgisprgagytfgqdisetfnhangltlvsrah
qlvmegynwchdrnvvtifsapnycyrcgnqaaimelddtlkysflqfdpapr

Timeline for d2nymf1:

• d2nymf1 first appeared in SCOP 1.73
  
• d2nymf1 appears in SCOPe 2.07