SCOPe 2.08: Domain d2nymb1: 2nym B:28-415

Lineage for d2nymb1 (2nym B:28-415)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (28 families)

5. Family a.118.1.20: B56-like [140819] (1 protein)
   Pfam PF01603; Protein phosphatase 2A regulatory B subunit family

6. Protein Serine/threonine-protein phosphatase 2A regulatory subunit B56-gamma [140820] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140821] (6 PDB entries)
   Uniprot Q13362 30-372! Uniprot Q13362 38-425

8. Domain d2nymb1: 2nym B:28-415 [138822]
   Other proteins in same PDB: d2nyma1, d2nymc1, d2nymd1, d2nymf1
   automatically matched to 2NYL B:28-415
   complexed with mn

Details for d2nymb1

PDB Entry: 2nym, 3.6 Å

PDB Description: crystal structure of protein phosphatase 2a (pp2a) with c-terminus truncated catalytic subunit

PDB Compounds: (B:) serine/threonine-protein phosphatase 2a 56 kda regulatory subunit gamma isoform

SCOPe Domain Sequences for d2nymb1:

Sequence; same for both SEQRES and ATOM records:

>d2nymb1 a.118.1.20 (B:28-415) Serine/threonine-protein phosphatase 2A regulatory subunit B56-gamma {Human (Homo sapiens) [TaxId: 9606]}
qeklfiqklrqccvlfdfvsdplsdlkwkevkraalsemveyithnrnvitepiypevvh
mfavnmfrtlppssnptgaefdpeedeptleaawphlqlvyefflrflespdfqpniakk
yidqkfvlqllelfdsedprerdflkttlhriygkflglrayirkqinnifyrfiyeteh
hngiaelleilgsiingfalplkeehkifllkvllplhkvkslsvyhpqlaycvvqflek
dstltepvvmallkywpkthspkevmflneleeildviepsefvkimeplfrqlakcvss
phfqvaeralyywnneyimslisdnaakilpimfpslyrnskthwnktihgliynalklf
memnqklfddctqqfkaeklkeklkmke

Timeline for d2nymb1:

• d2nymb1 first appeared in SCOP 1.73
  
• d2nymb1 appears in SCOPe 2.07