Lineage for d2nwva1 (2nwv A:2-113)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011051Fold d.326: XisI-like [143846] (1 superfamily)
    alpha-beta(4)-alpha-beta-alpha; 2 layers, a/b; antiparallel beta-sheet, order 1234, meander; the open side of beta-sheet provides dimerization interface
  4. 3011052Superfamily d.326.1: XisI-like [143847] (2 families) (S)
  5. 3011053Family d.326.1.1: XisI-like [143848] (3 proteins)
    Pfam PF08869
  6. 3011054Protein Hypothetical protein Ava3320 [143853] (1 species)
  7. 3011055Species Anabaena variabilis [TaxId:1172] [143854] (1 PDB entry)
    Uniprot Q3M7V9 2-113
  8. 3011056Domain d2nwva1: 2nwv A:2-113 [138720]

Details for d2nwva1

PDB Entry: 2nwv (more details), 1.85 Å

PDB Description: crystal structure of xisi protein-like (yp_323822.1) from anabaena variabilis atcc 29413 at 1.85 a resolution
PDB Compounds: (A:) XisI protein-like

SCOPe Domain Sequences for d2nwva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nwva1 d.326.1.1 (A:2-113) Hypothetical protein Ava3320 {Anabaena variabilis [TaxId: 1172]}
dnvaeyrklikqvlteydnlsrqspetnyetclvfdenhdnylwlavdwqgskrikytyv
hiriknekiyieedyteegiatelmrlgvtnndivlafhppdvrkftdfata

SCOPe Domain Coordinates for d2nwva1:

Click to download the PDB-style file with coordinates for d2nwva1.
(The format of our PDB-style files is described here.)

Timeline for d2nwva1: