PDB entry 2nwv

View 2nwv on RCSB PDB site
Description: Crystal structure of XisI protein-like (YP_323822.1) from Anabaena Variabilis ATCC 29413 at 1.85 A resolution
Class: Structural Genomics/Unknown Function
Keywords: YP_323822.1, XisI protein-like, Structural Genomics, PSI-2, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG, Structural Genomics-Unknown Function COMPLEX
Deposited on 2006-11-16, released 2006-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: XisI protein-like
    Species: Anabaena variabilis [TaxId:1172]
    Gene: YP_323822.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nwva1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2nwvA (A:)
gmdnvaeyrklikqvlteydnlsrqspetnyetclvfdenhdnylwlavdwqgskrikyt
yvhiriknekiyieedyteegiatelmrlgvtnndivlafhppdvrkftdfata

    Sequence, based on observed residues (ATOM records): (download) 
    >2nwvA (A:)
dnvaeyrklikqvlteydnlsrqspetnyetclvfdenhdnylwlavdwqgskrikytyv
hiriknekiyieedyteegiatelmrlgvtnndivlafhppdvrkftdfata