SCOP 1.75: Domain d2nvzf1: 2nvz F:72-154

Lineage for d2nvzf1 (2nvz F:72-154)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
   core: 2 helices and adjacent loops

4. Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families)
   the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits

5. Family a.143.1.2: RPB6 [55294] (1 protein)

6. Protein RPB6 [55295] (2 species)
   essential subunit of RNA polymerases I, II and III

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (29 PDB entries)
   Uniprot P20435; part of multichain biological unit

8. Domain d2nvzf1: 2nvz F:72-154 [138699]
   Other proteins in same PDB: d2nvza1, d2nvzb1, d2nvzc1, d2nvzc2, d2nvze1, d2nvze2, d2nvzh1, d2nvzi1, d2nvzi2, d2nvzj1, d2nvzk1, d2nvzl1
   automatically matched to d1i3qf_
   complexed with mg, utp, zn

Details for d2nvzf1

PDB Entry: 2nvz, 4.3 Å

PDB Description: rna polymerase ii elongation complex with utp, updated 11/2006

PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

SCOP Domain Sequences for d2nvzf1:

Sequence; same for both SEQRES and ATOM records:

>d2nvzf1 a.143.1.2 (F:72-154) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivd

Timeline for d2nvzf1:

• d2nvzf1 first appeared in SCOP 1.73
  
• d2nvzf1 appears in SCOPe 2.01
  
• d2nvzf1 appears in the current release, SCOPe 2.08