Lineage for d2nvze1 (2nvz E:3-143)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835443Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 835824Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) (S)
  5. 835825Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (1 protein)
  6. 835826Protein Eukaryotic RPB5 N-terminal domain [53038] (1 species)
  7. 835827Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (25 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 835853Domain d2nvze1: 2nvz E:3-143 [138697]
    Other proteins in same PDB: d2nvza1, d2nvzb1, d2nvzc1, d2nvzc2, d2nvze2, d2nvzf1, d2nvzh1, d2nvzi1, d2nvzi2, d2nvzj1, d2nvzk1, d2nvzl1
    automatically matched to d1i3qe1
    complexed with mg, utp, zn

Details for d2nvze1

PDB Entry: 2nvz (more details), 4.3 Å

PDB Description: RNA Polymerase II elongation complex with UTP, updated 11/2006
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOP Domain Sequences for d2nvze1:

Sequence, based on SEQRES records: (download)

>d2nvze1 c.52.3.1 (E:3-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfqa
npteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsamk
lvpsippatietfneaalvvn

Sequence, based on observed residues (ATOM records): (download)

>d2nvze1 c.52.3.1 (E:3-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdrpqrkmmsfqanpt
eesiskfpdmgslwveftfvihiqeknfqtgifvtpsamklvpsippatietfneaalvv
n

SCOP Domain Coordinates for d2nvze1:

Click to download the PDB-style file with coordinates for d2nvze1.
(The format of our PDB-style files is described here.)

Timeline for d2nvze1: