SCOP 1.75: Domain d2nvze1: 2nvz E:3-143

Lineage for d2nvze1 (2nvz E:3-143)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family)

5. Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (1 protein)

6. Protein Eukaryotic RPB5 N-terminal domain [53038] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (25 PDB entries)
   Uniprot P20434; part of multichain biological unit

8. Domain d2nvze1: 2nvz E:3-143 [138697]
   Other proteins in same PDB: d2nvza1, d2nvzb1, d2nvzc1, d2nvzc2, d2nvze2, d2nvzf1, d2nvzh1, d2nvzi1, d2nvzi2, d2nvzj1, d2nvzk1, d2nvzl1
   automatically matched to d1i3qe1
   complexed with mg, utp, zn

Details for d2nvze1

PDB Entry: 2nvz, 4.3 Å

PDB Description: rna polymerase ii elongation complex with utp, updated 11/2006

PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOP Domain Sequences for d2nvze1:

Sequence, based on SEQRES records:

>d2nvze1 c.52.3.1 (E:3-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfqa
npteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsamk
lvpsippatietfneaalvvn

Sequence, based on observed residues (ATOM records):

>d2nvze1 c.52.3.1 (E:3-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdrpqrkmmsfqanpt
eesiskfpdmgslwveftfvihiqeknfqtgifvtpsamklvpsippatietfneaalvv
n

Timeline for d2nvze1:

• d2nvze1 first appeared in SCOP 1.73
  
• d2nvze1 appears in SCOPe 2.01
  
• d2nvze1 appears in the current release, SCOPe 2.08