Lineage for d2ntcb1 (2ntc B:133-256)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 867441Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 867442Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (5 families) (S)
  5. 867443Family d.89.1.1: The origin DNA-binding domain of SV40 T-antigen [55465] (1 protein)
  6. 867444Protein The origin DNA-binding domain of SV40 T-antigen [55466] (1 species)
  7. 867445Species Simian virus 40, Sv40 [TaxId:10633] [55467] (9 PDB entries)
  8. 867452Domain d2ntcb1: 2ntc B:133-256 [138578]
    automatically matched to d1tbd__

Details for d2ntcb1

PDB Entry: 2ntc (more details), 2.4 Å

PDB Description: Crystal Structure of sv40 large T antigen origin binding domain with DNA
PDB Compounds: (B:) large t antigen

SCOP Domain Sequences for d2ntcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ntcb1 d.89.1.1 (B:133-256) The origin DNA-binding domain of SV40 T-antigen {Simian virus 40, Sv40 [TaxId: 10633]}
edpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhnsynh
nilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieeslpggl
kehd

SCOP Domain Coordinates for d2ntcb1:

Click to download the PDB-style file with coordinates for d2ntcb1.
(The format of our PDB-style files is described here.)

Timeline for d2ntcb1: