SCOP 1.73: Domain d2ntcb1: 2ntc B:133-256

Lineage for d2ntcb1 (2ntc B:133-256)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
   alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325

4. Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (5 families)

5. Family d.89.1.1: The origin DNA-binding domain of SV40 T-antigen [55465] (1 protein)

6. Protein The origin DNA-binding domain of SV40 T-antigen [55466] (1 species)

7. Species Simian virus 40, Sv40 [TaxId:10633] [55467] (9 PDB entries)

8. Domain d2ntcb1: 2ntc B:133-256 [138578]
   automatically matched to d1tbd__

Details for d2ntcb1

PDB Entry: 2ntc, 2.4 Å

PDB Description: Crystal Structure of sv40 large T antigen origin binding domain with DNA

PDB Compounds: (B:) large t antigen

SCOP Domain Sequences for d2ntcb1:

Sequence; same for both SEQRES and ATOM records:

>d2ntcb1 d.89.1.1 (B:133-256) The origin DNA-binding domain of SV40 T-antigen {Simian virus 40, Sv40 [TaxId: 10633]}
edpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhnsynh
nilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieeslpggl
kehd

Timeline for d2ntcb1:

• d2ntcb1 is new in SCOP 1.73
  
• d2ntcb1 appears in SCOP 1.75
  
• d2ntcb1 appears in the current release, SCOPe 2.08, called d2ntcb_