Class b: All beta proteins [48724] (174 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins) interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain |
Protein Glucosylceramidase [89389] (1 species) glycosyl hydrolase family 30; the N-terminal extension wraps around the C-terminal core |
Species Human (Homo sapiens) [TaxId:9606] [89390] (11 PDB entries) |
Domain d2nt0c1: 2nt0 C:1-77,C:432-497 [138565] Other proteins in same PDB: d2nt0a2, d2nt0b2, d2nt0c2, d2nt0d2 automatically matched to d1ogsa1 complexed with gol, nag, so4 |
PDB Entry: 2nt0 (more details), 1.79 Å
SCOP Domain Sequences for d2nt0c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nt0c1 b.71.1.2 (C:1-77,C:432-497) Glucosylceramidase {Human (Homo sapiens) [TaxId: 9606]} arpcipksfgyssvvcvcnatycdsfdpptfpalgtfsryestrsgrrmelsmgpiqanh tgtgllltlqpeqkfqkXqrvglvasqkndldavalmhpdgsavvvvlnrsskdvpltik dpavgfletispgysihtylwhrq
Timeline for d2nt0c1: