SCOPe 2.08: Domain d2nt0c1: 2nt0 C:1-77,C:432-497

Lineage for d2nt0c1 (2nt0 C:1-77,C:432-497)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
   interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain

6. Protein Glucosylceramidase [89389] (1 species)
   glycosyl hydrolase family 30; the N-terminal extension wraps around the C-terminal core

7. Species Human (Homo sapiens) [TaxId:9606] [89390] (23 PDB entries)

8. Domain d2nt0c1: 2nt0 C:1-77,C:432-497 [138565]
   Other proteins in same PDB: d2nt0a2, d2nt0b2, d2nt0c2, d2nt0d2
   automated match to d1ogsa1
   complexed with gol, nag, so4

Details for d2nt0c1

PDB Entry: 2nt0, 1.79 Å

PDB Description: acid-beta-glucosidase low ph, glycerol bound

PDB Compounds: (C:) glucosylceramidase

SCOPe Domain Sequences for d2nt0c1:

Sequence; same for both SEQRES and ATOM records:

>d2nt0c1 b.71.1.2 (C:1-77,C:432-497) Glucosylceramidase {Human (Homo sapiens) [TaxId: 9606]}
arpcipksfgyssvvcvcnatycdsfdpptfpalgtfsryestrsgrrmelsmgpiqanh
tgtgllltlqpeqkfqkXqrvglvasqkndldavalmhpdgsavvvvlnrsskdvpltik
dpavgfletispgysihtylwhrq

Timeline for d2nt0c1:

• d2nt0c1 first appeared in SCOP 1.73
  
• d2nt0c1 appears in SCOPe 2.07