Lineage for d2nt0d1 (2nt0 D:1-77,D:432-497)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810765Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
    interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain
  6. 2810824Protein Glucosylceramidase [89389] (1 species)
    glycosyl hydrolase family 30; the N-terminal extension wraps around the C-terminal core
  7. 2810825Species Human (Homo sapiens) [TaxId:9606] [89390] (23 PDB entries)
  8. 2810831Domain d2nt0d1: 2nt0 D:1-77,D:432-497 [138567]
    Other proteins in same PDB: d2nt0a2, d2nt0b2, d2nt0c2, d2nt0d2
    automated match to d1ogsa1
    complexed with gol, nag, so4

Details for d2nt0d1

PDB Entry: 2nt0 (more details), 1.79 Å

PDB Description: acid-beta-glucosidase low ph, glycerol bound
PDB Compounds: (D:) glucosylceramidase

SCOPe Domain Sequences for d2nt0d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nt0d1 b.71.1.2 (D:1-77,D:432-497) Glucosylceramidase {Human (Homo sapiens) [TaxId: 9606]}
arpcipksfgyssvvcvcnatycdsfdpptfpalgtfsryestrsgrrmelsmgpiqanh
tgtgllltlqpeqkfqkXqrvglvasqkndldavalmhpdgsavvvvlnrsskdvpltik
dpavgfletispgysihtylwhrq

SCOPe Domain Coordinates for d2nt0d1:

Click to download the PDB-style file with coordinates for d2nt0d1.
(The format of our PDB-style files is described here.)

Timeline for d2nt0d1: