![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.13: CoaX-like [142484] (1 protein) Pfam PF03309; Bordetella pertussis Bvg accessory factor family, Baf |
![]() | Protein Type III pantothenate kinase, CoaX [142485] (3 species) |
![]() | Species Campylobacter jejuni [TaxId:197] [142488] (1 PDB entry) Uniprot Q5HW73 1-82! Uniprot Q5HW73 83-208 |
![]() | Domain d2nrha2: 2nrh A:83-208 [138524] complexed with so4 |
PDB Entry: 2nrh (more details), 2.3 Å
SCOPe Domain Sequences for d2nrha2:
Sequence, based on SEQRES records: (download)
>d2nrha2 c.55.1.13 (A:83-208) Type III pantothenate kinase, CoaX {Campylobacter jejuni [TaxId: 197]} edgvvvdagsaitidiisnsihlggfilpgianykkiyshisprlksefntqvsldafpq ktmdalsygvfkgiyllikdaaqnkklyftggdgqflanyfdhaiydkllifrgmkkiik enpnll
>d2nrha2 c.55.1.13 (A:83-208) Type III pantothenate kinase, CoaX {Campylobacter jejuni [TaxId: 197]} edgvvvdagsaitidiihlggfilpgianykkiyshispfntqvsldafpqktmdalsyg vfkgiyllikdaaqnkklyftggdgqflanyfdhaiydkllifrgmkkiikenpnll
Timeline for d2nrha2: