Lineage for d2nrha2 (2nrh A:83-208)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 995077Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 995746Family c.55.1.13: CoaX-like [142484] (1 protein)
    Pfam PF03309; Bordetella pertussis Bvg accessory factor family, Baf
  6. 995747Protein Type III pantothenate kinase, CoaX [142485] (3 species)
  7. 995748Species Campylobacter jejuni [TaxId:197] [142488] (1 PDB entry)
    Uniprot Q5HW73 1-82! Uniprot Q5HW73 83-208
  8. 995750Domain d2nrha2: 2nrh A:83-208 [138524]
    complexed with so4

Details for d2nrha2

PDB Entry: 2nrh (more details), 2.3 Å

PDB Description: crystal structure of conserved putative baf family transcriptional activator from campylobacter jejuni
PDB Compounds: (A:) Transcriptional activator, putative, Baf family

SCOPe Domain Sequences for d2nrha2:

Sequence, based on SEQRES records: (download)

>d2nrha2 c.55.1.13 (A:83-208) Type III pantothenate kinase, CoaX {Campylobacter jejuni [TaxId: 197]}
edgvvvdagsaitidiisnsihlggfilpgianykkiyshisprlksefntqvsldafpq
ktmdalsygvfkgiyllikdaaqnkklyftggdgqflanyfdhaiydkllifrgmkkiik
enpnll

Sequence, based on observed residues (ATOM records): (download)

>d2nrha2 c.55.1.13 (A:83-208) Type III pantothenate kinase, CoaX {Campylobacter jejuni [TaxId: 197]}
edgvvvdagsaitidiihlggfilpgianykkiyshispfntqvsldafpqktmdalsyg
vfkgiyllikdaaqnkklyftggdgqflanyfdhaiydkllifrgmkkiikenpnll

SCOPe Domain Coordinates for d2nrha2:

Click to download the PDB-style file with coordinates for d2nrha2.
(The format of our PDB-style files is described here.)

Timeline for d2nrha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nrha1