Lineage for d2nqvb2 (2nqv B:7-177)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1140866Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
    complex fold made of bifurcated and coiled b-sheets
  4. 1140867Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) (S)
  5. 1140868Family b.103.1.1: MoeA N-terminal region -like [63883] (2 proteins)
  6. 1140876Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species)
  7. 1140877Species Escherichia coli [TaxId:562] [63885] (14 PDB entries)
  8. 1140903Domain d2nqvb2: 2nqv B:7-177 [138512]
    Other proteins in same PDB: d2nqva1, d2nqva3, d2nqvb1, d2nqvb3
    automatically matched to d1fc5a2
    complexed with gol

Details for d2nqvb2

PDB Entry: 2nqv (more details), 2.82 Å

PDB Description: moea d228a
PDB Compounds: (B:) Molybdopterin biosynthesis protein moeA

SCOPe Domain Sequences for d2nqvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqvb2 b.103.1.1 (B:7-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]}
lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk

SCOPe Domain Coordinates for d2nqvb2:

Click to download the PDB-style file with coordinates for d2nqvb2.
(The format of our PDB-style files is described here.)

Timeline for d2nqvb2: