Lineage for d2nqva1 (2nqv A:327-409)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 964422Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 964721Superfamily b.85.6: MoeA C-terminal domain-like [63867] (1 family) (S)
  5. 964722Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)
  6. 964730Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species)
  7. 964731Species Escherichia coli [TaxId:562] [63870] (14 PDB entries)
  8. 964756Domain d2nqva1: 2nqv A:327-409 [138508]
    Other proteins in same PDB: d2nqva2, d2nqva3, d2nqvb2, d2nqvb3
    automatically matched to d1g8la1
    complexed with gol

Details for d2nqva1

PDB Entry: 2nqv (more details), 2.82 Å

PDB Description: moea d228a
PDB Compounds: (A:) Molybdopterin biosynthesis protein moeA

SCOPe Domain Sequences for d2nqva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqva1 b.85.6.1 (A:327-409) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Escherichia coli [TaxId: 562]}
lparqrvrtasrlkktpgrldfqrgvlqrnadgelevtttghqgshifssfslgncfivl
erdrgnvevgewvevepfnalfg

SCOPe Domain Coordinates for d2nqva1:

Click to download the PDB-style file with coordinates for d2nqva1.
(The format of our PDB-style files is described here.)

Timeline for d2nqva1: