Class b: All beta proteins [48724] (165 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.6: MoeA C-terminal domain-like [63867] (1 family) |
Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins) |
Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species) |
Species Escherichia coli [TaxId:562] [63870] (14 PDB entries) |
Domain d2nqqa1: 2nqq A:327-409 [138478] Other proteins in same PDB: d2nqqa2, d2nqqa3, d2nqqb2, d2nqqb3, d2nqqc2, d2nqqc3, d2nqqd2, d2nqqd3 automatically matched to d1g8la1 complexed with gol; mutant |
PDB Entry: 2nqq (more details), 2.4 Å
SCOP Domain Sequences for d2nqqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nqqa1 b.85.6.1 (A:327-409) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Escherichia coli [TaxId: 562]} lparqrvrtasrlkktpgrldfqrgvlqrnadgelevtttghqgshifssfslgncfivl erdrgnvevgewvevepfnalfg
Timeline for d2nqqa1: