Lineage for d2nqqc2 (2nqq C:7-177)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 679239Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
    complex fold made of bifurcated and coiled b-sheets
  4. 679240Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) (S)
  5. 679241Family b.103.1.1: MoeA N-terminal region -like [63883] (2 proteins)
  6. 679249Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species)
  7. 679252Species Escherichia coli [TaxId:562] [63885] (14 PDB entries)
  8. 679263Domain d2nqqc2: 2nqq C:7-177 [138485]
    Other proteins in same PDB: d2nqqa1, d2nqqa3, d2nqqb1, d2nqqb3, d2nqqc1, d2nqqc3, d2nqqd1, d2nqqd3
    automatically matched to d1fc5a2
    complexed with gol; mutant

Details for d2nqqc2

PDB Entry: 2nqq (more details), 2.4 Å

PDB Description: moea r137q
PDB Compounds: (C:) Molybdopterin biosynthesis protein moeA

SCOP Domain Sequences for d2nqqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqqc2 b.103.1.1 (C:7-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]}
lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
taevrsgqniqrrgedisagavvfpagtrlttaelpviaslgiaevpvirk

SCOP Domain Coordinates for d2nqqc2:

Click to download the PDB-style file with coordinates for d2nqqc2.
(The format of our PDB-style files is described here.)

Timeline for d2nqqc2: