Class b: All beta proteins [48724] (180 folds) |
Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily) complex fold made of bifurcated and coiled b-sheets |
Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) automatically mapped to Pfam PF03453 |
Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins) |
Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species) |
Species Escherichia coli [TaxId:562] [63885] (14 PDB entries) |
Domain d2nqna2: 2nqn A:6-177 [138468] Other proteins in same PDB: d2nqna1, d2nqna3, d2nqnb1, d2nqnb3 automated match to d1g8la2 complexed with gol |
PDB Entry: 2nqn (more details), 2.2 Å
SCOPe Domain Sequences for d2nqna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nqna2 b.103.1.1 (A:6-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]} glmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrl adiasgqplpvagksfagqpyhgewpagtcirimwgapvpegceavvmqeqteqmdngvr ftaevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk
Timeline for d2nqna2: