SCOPe 2.08: Domain d2nqnb2: 2nqn B:6-177

Lineage for d2nqnb2 (2nqn B:6-177)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
   complex fold made of bifurcated and coiled b-sheets

4. Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family)
   automatically mapped to Pfam PF03453

5. Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins)

6. Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species)

7. Species Escherichia coli [TaxId:562] [63885] (14 PDB entries)

8. Domain d2nqnb2: 2nqn B:6-177 [138471]
   Other proteins in same PDB: d2nqna1, d2nqna3, d2nqnb1, d2nqnb3
   automated match to d1g8la2
   complexed with gol

Details for d2nqnb2

PDB Entry: 2nqn, 2.2 Å

PDB Description: moea t100w

PDB Compounds: (B:) Molybdopterin biosynthesis protein moeA

SCOPe Domain Sequences for d2nqnb2:

Sequence; same for both SEQRES and ATOM records:

>d2nqnb2 b.103.1.1 (B:6-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]}
glmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrl
adiasgqplpvagksfagqpyhgewpagtcirimwgapvpegceavvmqeqteqmdngvr
ftaevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk

Timeline for d2nqnb2:

• d2nqnb2 first appeared in SCOP 1.73
  
• d2nqnb2 appears in SCOPe 2.07