| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (19 families) ![]() consists only of helices |
| Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins) |
| Protein Putative transcriptional regulator SCO0857 [140207] (1 species) |
| Species Streptomyces coelicolor [TaxId:1902] [140208] (1 PDB entry) Uniprot Q9RCV4 35-99 |
| Domain d2np3b1: 2np3 B:35-99 [138422] Other proteins in same PDB: d2np3a2, d2np3b2 automatically matched to 2NP3 A:35-99 |
PDB Entry: 2np3 (more details), 2.35 Å
SCOP Domain Sequences for d2np3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2np3b1 a.4.1.9 (B:35-99) Putative transcriptional regulator SCO0857 {Streptomyces coelicolor [TaxId: 1902]}
iltaarvcfaergfdatslrriaetagvdqslvhhfygtkenlflqalelpgkieeaita
aaqgg
Timeline for d2np3b1: