Lineage for d2noea1 (2noe A:136-325)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2720979Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2720980Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2721021Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins)
  6. 2721062Protein 8-oxoguanine glycosylase [48160] (2 species)
  7. 2721063Species Human (Homo sapiens) [TaxId:9606] [48161] (24 PDB entries)
  8. 2721080Domain d2noea1: 2noe A:136-325 [138405]
    Other proteins in same PDB: d2noea2, d2noea3
    automated match to d1ebma1
    protein/DNA complex; complexed with ca

Details for d2noea1

PDB Entry: 2noe (more details), 2.2 Å

PDB Description: structure of catalytically inactive g42a human 8-oxoguanine glycosylase complexed to 8-oxoguanine dna
PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d2noea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2noea1 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtqvadcic
lmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq
avlfsadlrq

SCOPe Domain Coordinates for d2noea1:

Click to download the PDB-style file with coordinates for d2noea1.
(The format of our PDB-style files is described here.)

Timeline for d2noea1: