SCOPe 2.03: Domain d2ji1a1: 2ji1 A:39-126

Lineage for d2ji1a1 (2ji1 A:39-126)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.13: Superoxide reductase-like [49367] (2 families)

5. Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins)
   binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins
   automatically mapped to Pfam PF01880

6. Protein Desulfoferrodoxin C-terminal domain [49371] (2 species)

7. Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [110068] (6 PDB entries)
   Uniprot Q46495

8. Domain d2ji1a1: 2ji1 A:39-126 [138331]
   Other proteins in same PDB: d2ji1a2, d2ji1b2, d2ji1c2, d2ji1d2
   automatically matched to d1dfx_1
   complexed with ca, fe, fe2

Details for d2ji1a1

PDB Entry: 2ji1, 1.7 Å

PDB Description: x-ray structure of wild-type superoxide reductase from desulfoarculus baarsii

PDB Compounds: (A:) desulfoferrodoxin

SCOPe Domain Sequences for d2ji1a1:

Sequence; same for both SEQRES and ATOM records:

>d2ji1a1 b.1.13.1 (A:39-126) Desulfoferrodoxin C-terminal domain {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]}
entvdaakekhvpviekidggykvkvgavahpmeekhyiqwielladdkcytqflkpgqa
peavflieaakvvareycnihghwkaen

Timeline for d2ji1a1:

• d2ji1a1 first appeared in SCOP 1.73
  
• d2ji1a1 appears in SCOPe 2.02
  
• d2ji1a1 appears in SCOPe 2.04
  
• d2ji1a1 appears in the current release, SCOPe 2.08