SCOP 1.75: Domain d2jffa1: 2jff A:1-93

Lineage for d2jffa1 (2jff A:1-93)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group

4. Superfamily c.5.1: MurCD N-terminal domain [51984] (1 family)

5. Family c.5.1.1: MurCD N-terminal domain [51985] (2 proteins)

6. Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [51986] (1 species)

7. Species Escherichia coli [TaxId:562] [51987] (11 PDB entries)

8. Domain d2jffa1: 2jff A:1-93 [138303]
   Other proteins in same PDB: d2jffa2, d2jffa3
   automatically matched to d1e0da1
   complexed with lk2, so4

Details for d2jffa1

PDB Entry: 2jff, 1.89 Å

PDB Description: crystal structure of murd ligase in complex with d-glu containing sulfonamide inhibitor

PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOP Domain Sequences for d2jffa1:

Sequence; same for both SEQRES and ATOM records:

>d2jffa1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
wlmaadlivaspgialahpslsaaadagieivg

Timeline for d2jffa1:

• d2jffa1 first appeared in SCOP 1.73
  
• d2jffa1 appears in SCOPe 2.01
  
• d2jffa1 appears in the current release, SCOPe 2.08