Lineage for d2jfcc1 (2jfc C:2-159)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381028Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2381772Protein automated matches [226877] (4 species)
    not a true protein
  7. 2381787Species Achromobacter xylosoxidans [TaxId:85698] [225099] (11 PDB entries)
  8. 2381824Domain d2jfcc1: 2jfc C:2-159 [138295]
    automated match to d1gs7a1
    complexed with cl, cu; mutant

Details for d2jfcc1

PDB Entry: 2jfc (more details), 2.4 Å

PDB Description: m144l mutant of nitrite reductase from alcaligenes xylosoxidans in space group p212121
PDB Compounds: (C:) dissimilatory copper-containing nitrite reductase

SCOPe Domain Sequences for d2jfcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jfcc1 b.6.1.3 (C:2-159) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
rsgtfvyhcapegmvpwhvvsglsgtlmvlprdglkdp

SCOPe Domain Coordinates for d2jfcc1:

Click to download the PDB-style file with coordinates for d2jfcc1.
(The format of our PDB-style files is described here.)

Timeline for d2jfcc1: