![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
![]() | Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) ![]() "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
![]() | Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins) contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein automated matches [231300] (5 species) not a true protein |
![]() | Species Sulfolobus solfataricus [TaxId:273057] [231301] (28 PDB entries) |
![]() | Domain d2jeia2: 2jei A:1-240 [138283] Other proteins in same PDB: d2jeia1, d2jeia3 automated match to d2v4ra1 complexed with ca, dgt |
PDB Entry: 2jei (more details), 2.39 Å
SCOPe Domain Sequences for d2jeia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jeia2 e.8.1.7 (A:1-240) automated matches {Sulfolobus solfataricus [TaxId: 273057]} mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr
Timeline for d2jeia2: