![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.74: DCoH-like [55247] (4 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
![]() | Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) ![]() form homo and heterodimers |
![]() | Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins) |
![]() | Protein RPB3 [64315] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries) |
![]() | Domain d2ja8c1: 2ja8 C:3-37,C:173-268 [138224] Other proteins in same PDB: d2ja8a1, d2ja8b1, d2ja8c2, d2ja8d1, d2ja8e1, d2ja8e2, d2ja8f1, d2ja8g1, d2ja8g2, d2ja8h1, d2ja8i1, d2ja8i2, d2ja8j1, d2ja8k1, d2ja8l1 automatically matched to d1i3qc1 complexed with bru, mg, tt, zn |
PDB Entry: 2ja8 (more details), 3.8 Å
SCOP Domain Sequences for d2ja8c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ja8c1 d.74.3.1 (C:3-37,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} eegpqvkireaskdnvdfilsnvdlamanslrrvmXaaaiefeydpwnklkhtdywyeqd sakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlqkkva sillaltqmdqd
Timeline for d2ja8c1: