SCOP 1.73: Domain d2ja8g2: 2ja8 G:1-80

Lineage for d2ja8g2 (2ja8 G:1-80)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.230: Dodecin subunit-like [88797] (5 superfamilies)
   beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132

4. Superfamily d.230.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88798] (1 family)

5. Family d.230.1.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88799] (1 protein)

6. Protein N-terminal, heterodimerisation domain of RBP7 (RpoE) [88800] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117777] (6 PDB entries)

8. Domain d2ja8g2: 2ja8 G:1-80 [138231]
   Other proteins in same PDB: d2ja8a1, d2ja8b1, d2ja8c1, d2ja8c2, d2ja8d1, d2ja8e1, d2ja8e2, d2ja8f1, d2ja8g1, d2ja8h1, d2ja8i1, d2ja8i2, d2ja8j1, d2ja8k1, d2ja8l1
   automatically matched to d1y14b2
   complexed with bru, mg, tt, zn

Details for d2ja8g2

PDB Entry: 2ja8, 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex d

PDB Compounds: (G:) DNA-directed RNA polymerase II 19kda polypeptide

SCOP Domain Sequences for d2ja8g2:

Sequence; same for both SEQRES and ATOM records:

>d2ja8g2 d.230.1.1 (G:1-80) N-terminal, heterodimerisation domain of RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mffikdlslnitlhpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqrgr
ilptdgsaefnvkyravvfk

Timeline for d2ja8g2:

• d2ja8g2 is new in SCOP 1.73
  
• d2ja8g2 appears in SCOP 1.75
  
• d2ja8g2 appears in the current release, SCOPe 2.08