Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.230: Dodecin subunit-like [88797] (5 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
Superfamily d.230.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88798] (1 family) |
Family d.230.1.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88799] (1 protein) |
Protein N-terminal, heterodimerisation domain of RBP7 (RpoE) [88800] (3 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117777] (6 PDB entries) |
Domain d2ja8g2: 2ja8 G:1-80 [138231] Other proteins in same PDB: d2ja8a1, d2ja8b1, d2ja8c1, d2ja8c2, d2ja8d1, d2ja8e1, d2ja8e2, d2ja8f1, d2ja8g1, d2ja8h1, d2ja8i1, d2ja8i2, d2ja8j1, d2ja8k1, d2ja8l1 automatically matched to d1y14b2 complexed with bru, mg, tt, zn |
PDB Entry: 2ja8 (more details), 3.8 Å
SCOP Domain Sequences for d2ja8g2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ja8g2 d.230.1.1 (G:1-80) N-terminal, heterodimerisation domain of RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mffikdlslnitlhpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqrgr ilptdgsaefnvkyravvfk
Timeline for d2ja8g2: