|  | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) | 
|  | Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit | 
|  | Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)  automatically mapped to Pfam PF01000 | 
|  | Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins) | 
|  | Protein RPB3 [64462] (2 species) | 
|  | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries) Uniprot P16370; part of multichain biological unit | 
|  | Domain d2ja6c2: 2ja6 C:42-172 [138177] Other proteins in same PDB: d2ja6a1, d2ja6b1, d2ja6c1, d2ja6d1, d2ja6e1, d2ja6e2, d2ja6f1, d2ja6g1, d2ja6g2, d2ja6h1, d2ja6i1, d2ja6i2, d2ja6j1, d2ja6k1, d2ja6l1 automatically matched to d1i3qc2 protein/DNA complex; protein/RNA complex; complexed with mg, zn | 
PDB Entry: 2ja6 (more details), 4 Å
SCOPe Domain Sequences for d2ja6c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ja6c2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl
qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk
giakehakwgp
Timeline for d2ja6c2: