Lineage for d2ja6c2 (2ja6 C:42-172)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 739032Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 739033Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
  5. 739034Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 739087Protein RPB3 [64462] (1 species)
  7. 739088Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries)
  8. 739111Domain d2ja6c2: 2ja6 C:42-172 [138177]
    Other proteins in same PDB: d2ja6a1, d2ja6b1, d2ja6c1, d2ja6d1, d2ja6e1, d2ja6e2, d2ja6f1, d2ja6g1, d2ja6g2, d2ja6h1, d2ja6i1, d2ja6i2, d2ja6j1, d2ja6k1, d2ja6l1
    automatically matched to d1i3qc2
    complexed with bru, mg, tt, zn

Details for d2ja6c2

PDB Entry: 2ja6 (more details), 4 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex b
PDB Compounds: (C:) DNA-directed RNA polymerase II 45kda polypeptide

SCOP Domain Sequences for d2ja6c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja6c2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl
qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk
giakehakwgp

SCOP Domain Coordinates for d2ja6c2:

Click to download the PDB-style file with coordinates for d2ja6c2.
(The format of our PDB-style files is described here.)

Timeline for d2ja6c2: