![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
![]() | Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) ![]() form homo and heterodimers |
![]() | Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins) |
![]() | Protein RPB3 [64315] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries) Uniprot P16370; part of multichain biological unit |
![]() | Domain d2ja5c1: 2ja5 C:3-37,C:173-268 [138160] Other proteins in same PDB: d2ja5a1, d2ja5b1, d2ja5c2, d2ja5d1, d2ja5e1, d2ja5e2, d2ja5f1, d2ja5g1, d2ja5g2, d2ja5h1, d2ja5i1, d2ja5i2, d2ja5j1, d2ja5k1, d2ja5l1 automatically matched to d1i3qc1 protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 2ja5 (more details), 3.8 Å
SCOPe Domain Sequences for d2ja5c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ja5c1 d.74.3.1 (C:3-37,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} eegpqvkireaskdnvdfilsnvdlamanslrrvmXaaaiefeydpwnklkhtdywyeqd sakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlqkkva sillaltqmdqd
Timeline for d2ja5c1: