SCOP 1.73: Domain d2ja5c1: 2ja5 C:3-37,C:173-268

Lineage for d2ja5c1 (2ja5 C:3-37,C:173-268)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.74: DCoH-like [55247] (4 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)

6. Protein RPB3 [64315] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries)

8. Domain d2ja5c1: 2ja5 C:3-37,C:173-268 [138160]
   Other proteins in same PDB: d2ja5a1, d2ja5b1, d2ja5c2, d2ja5d1, d2ja5e1, d2ja5e2, d2ja5f1, d2ja5g1, d2ja5g2, d2ja5h1, d2ja5i1, d2ja5i2, d2ja5j1, d2ja5k1, d2ja5l1
   automatically matched to d1i3qc1
   complexed with bru, mg, zn

Details for d2ja5c1

PDB Entry: 2ja5, 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex a

PDB Compounds: (C:) DNA-directed RNA polymerase II 45kda polypeptide

SCOP Domain Sequences for d2ja5c1:

Sequence; same for both SEQRES and ATOM records:

>d2ja5c1 d.74.3.1 (C:3-37,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eegpqvkireaskdnvdfilsnvdlamanslrrvmXaaaiefeydpwnklkhtdywyeqd
sakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlqkkva
sillaltqmdqd

Timeline for d2ja5c1:

• d2ja5c1 is new in SCOP 1.73
  
• d2ja5c1 appears in SCOP 1.75
  
• d2ja5c1 appears in the current release, SCOPe 2.08