Lineage for d2j7xa_ (2j7x A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011944Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2011945Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2011946Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2012913Protein automated matches [190059] (14 species)
    not a true protein
  7. 2013254Species Norway rat (Rattus norvegicus) [TaxId:10116] [187147] (4 PDB entries)
  8. 2013257Domain d2j7xa_: 2j7x A: [138129]
    automated match to d1qkna_
    complexed with bct, edo, est, so4

Details for d2j7xa_

PDB Entry: 2j7x (more details), 2.1 Å

PDB Description: structure of estradiol-bound estrogen receptor beta lbd in complex with lxxll motif from ncoa5
PDB Compounds: (A:) Estrogen receptor beta

SCOPe Domain Sequences for d2j7xa_:

Sequence, based on SEQRES records: (download)

>d2j7xa_ a.123.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tlspeqlvltlleaeppnvlvsrpsmpfteasmmmsltkladkelvhmigwakkipgfve
lslldqvrllescwmevlmvglmwrsidhpgklifapdlvldrdegkcvegileifdmll
attsrfrelklqhkeylcvkamillnssmyplasanqeaessrklthllnavtdalvwvi
aksgissqqqsvrlanllmllshvrhisnkgmehllsmkcknvvpvydlllemlnah

Sequence, based on observed residues (ATOM records): (download)

>d2j7xa_ a.123.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tlspeqlvltlleaeppnvlvsmpfteasmmmsltkladkelvhmigwakkipgfvelsl
ldqvrllescwmevlmvglmwrsidhpgklifapdlvldrdegkcvegileifdmllatt
srfrelklqhkeylcvkamillnssmyplaessrklthllnavtdalvwviaksgissqq
qsvrlanllmllshvrhisnkgmehllsmkcknvvpvydlllemlnah

SCOPe Domain Coordinates for d2j7xa_:

Click to download the PDB-style file with coordinates for d2j7xa_.
(The format of our PDB-style files is described here.)

Timeline for d2j7xa_: