Lineage for d2j6ua1 (2j6u A:244-345)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2240610Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 2240611Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 2240711Family d.240.1.0: automated matches [231323] (1 protein)
    not a true family
  6. 2240712Protein automated matches [231324] (4 species)
    not a true protein
  7. 2240732Species Sulfolobus solfataricus [TaxId:273057] [231327] (33 PDB entries)
  8. 2240760Domain d2j6ua1: 2j6u A:244-345 [138093]
    Other proteins in same PDB: d2j6ua2, d2j6ua3
    automated match to d2v4ra2
    protein/DNA complex; complexed with ca, dgt

Details for d2j6ua1

PDB Entry: 2j6u (more details), 2.5 Å

PDB Description: ternary complex of sulfolobus solfataricus dpo4 dna polymerase, o6-methylguanine modified dna, and dgtp.
PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d2j6ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j6ua1 d.240.1.0 (A:244-345) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfie

SCOPe Domain Coordinates for d2j6ua1:

Click to download the PDB-style file with coordinates for d2j6ua1.
(The format of our PDB-style files is described here.)

Timeline for d2j6ua1: