SCOPe 2.06: Domain d2j6ba1: 2j6b A:1-109

Lineage for d2j6ba1 (2j6b A:1-109)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.321: STIV B116-like [143601] (1 superfamily)
   subunit fold consists of mixed 5-stranded beta-sheet, order:31452, strand 5 is antiparallel to the rest, with 3 helices on one side; dimerises with the formation of a single 10-stranded beta-sheet; strand 2 is in the dimer interface

4. Superfamily d.321.1: STIV B116-like [143602] (2 families)

5. Family d.321.1.1: STIV B116-like [143603] (3 proteins)
   automatically mapped to Pfam PF08960

6. Protein Afv3-109 [143606] (1 species)

7. Species Acidianus filamentous virus 1 [TaxId:235266] [143607] (2 PDB entries)

8. Domain d2j6ba1: 2j6b A:1-109 [138078]

Details for d2j6ba1

PDB Entry: 2j6b, 1.3 Å

PDB Description: crystal structure of afv3-109, a highly conserved protein from crenarchaeal viruses

PDB Compounds: (A:) afv3-109

SCOPe Domain Sequences for d2j6ba1:

Sequence; same for both SEQRES and ATOM records:

>d2j6ba1 d.321.1.1 (A:1-109) Afv3-109 {Acidianus filamentous virus 1 [TaxId: 235266]}
mlyilnsailplkpgeeytvkakeitiqeakelvtkeqftsaighqataellssilgvnv
pmnrvqikvthgdrilafmlkqrlpegvvvktteelekigyelwlfeiq

Timeline for d2j6ba1:

• d2j6ba1 first appeared in SCOP 1.73
  
• d2j6ba1 appears in SCOPe 2.05
  
• d2j6ba1 appears in SCOPe 2.07
  
• d2j6ba1 appears in the current release, SCOPe 2.08